PDB entry 1ckg

View 1ckg on RCSB PDB site
Description: t52v mutant human lysozyme
Deposited on 1999-04-22, released 1999-05-05
The last revision prior to the SCOP 1.57 freeze date was dated 1999-12-15, with a file datestamp of 1999-12-14.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.166
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1ckga_
  • Chain 'B':
    Domains in SCOP 1.57: d1ckgb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ckgA (A:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrsvdygifqin
    srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ckgB (B:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrsvdygifqin
    srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv