PDB entry 1ck6

View 1ck6 on RCSB PDB site
Description: binding mode of salicylhydroxamic acid to arthromyces ramosus peroxidase
Class: oxidoreductase
Keywords: oxidoreductase, glycoprotein, peroxidase
Deposited on 1999-04-28, released 1999-12-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (peroxidase)
    Species: 'Arthromyces ramosus' [TaxId:5451]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ck6a_
  • Heterogens: NAG, BMA, CA, SHA, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ck6A (A:)
    qgpgggggsvtcpggqstsnsqccvwfdvlddlqtnfyqgskcespvrkilrivfhdaig
    fspaltaagqfggggadgsiiahsnielafpanggltdtiealravginhgvsfgdliqf
    atavgmsncpgsprlefltgrsnssqpsppslipgpgntvtaildrmgdagfspdevvdl
    laahslasqeglnsaifrspldstpqvfdtqfyietllkgttqpgpslgfaeelspfpge
    frmrsdallardsrtacrwqsmtssnevmgqryraamakmsvlgfdrnaltdcsdvipsa
    vsnnaapvipggltvddievscpsepfpeiatasgplpslapap
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ck6A (A:)
    svtcpggqstsnsqccvwfdvlddlqtnfyqgskcespvrkilrivfhdaigfspaltaa
    gqfggggadgsiiahsnielafpanggltdtiealravginhgvsfgdliqfatavgmsn
    cpgsprlefltgrsnssqpsppslipgpgntvtaildrmgdagfspdevvdllaahslas
    qeglnsaifrspldstpqvfdtqfyietllkgttqpgpslgfaeelspfpgefrmrsdal
    lardsrtacrwqsmtssnevmgqryraamakmsvlgfdrnaltdcsdvipsavsnnaapv
    ipggltvddievscpsepfpeiatasgplpslapap