PDB entry 1ck4

View 1ck4 on RCSB PDB site
Description: crystal structure of rat a1b1 integrin i-domain.
Deposited on 1999-04-27, released 2000-05-03
The last revision prior to the SCOP 1.59 freeze date was dated 2000-05-03, with a file datestamp of 2000-05-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.234
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1ck4a_
  • Chain 'B':
    Domains in SCOP 1.59: d1ck4b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ck4A (A:)
    tqldivivldgsnsiypwesviaflndllkrmdigpkqtqvgivqygenvthefnlnkys
    steevlvaankigrqgglqtmtalgidtarkeafteargarrgvkkvmvivtdgeshdny
    rlkqviqdcedeniqrfsiailghynrgnlstekfveeiksiaseptekhffnvsdelal
    vtivkalgerifa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ck4B (B:)
    tqldivivldgsnsiypwesviaflndllkrmdigpkqtqvgivqygenvthefnlnkys
    steevlvaankigrqgglqtmtalgidtarkeafteargarrgvkkvmvivtdgeshdny
    rlkqviqdcedeniqrfsiailghynrgnlstekfveeiksiaseptekhffnvsdelal
    vtivkalgerifale