PDB entry 1ck3

View 1ck3 on RCSB PDB site
Description: n276d mutant of escherichia coli tem-1 beta-lactamase
Class: hydrolase
Keywords: beta-lactamase, clavulanate-resistant, hydrolase
Deposited on 1999-04-27, released 1999-08-18
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.28 Å
R-factor: 0.165
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62593 (0-260)
      • engineered (58)
      • engineered (158)
      • engineered (248)
    Domains in SCOPe 2.05: d1ck3a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ck3A (A:)
    hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrid
    agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
    keltaflhnmgdhvtrldrwepelneaipnderdttmpvamattlrklltgelltlasrq
    qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
    sqatmderdrqiaeigaslikhw