PDB entry 1ck1

View 1ck1 on RCSB PDB site
Description: structure of staphylococcal enterotoxin c3
Class: toxin
Keywords: staphylococcal enterotoxin, superantigen, zinc
Deposited on 1999-04-26, released 2002-07-10
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.162
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (enterotoxin type c-3)
    Species: Staphylococcus aureus [TaxId:1280]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1ck1a1, d1ck1a2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ck1A (A:)
    esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdkflahdliynindkklnn
    ydkvktellnedlankykdevvdvygsnyyvncyfsskdnvgkvtsgktcmyggitkheg
    nhfdngnlqnvlirvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnssp
    yetgyikfiesngntfwydmmpapgdkfdqskylmiykdnkmvdsksvkievhlttkng