PDB entry 1ck1

View 1ck1 on RCSB PDB site
Description: structure of staphylococcal enterotoxin c3
Deposited on 1999-04-26, released 2002-07-10
The last revision prior to the SCOP 1.71 freeze date was dated 2002-07-10, with a file datestamp of 2002-07-10.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.162
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ck1A (A:)
    esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdkflahdliynindkklnn
    ydkvktellnedlankykdevvdvygsnyyvncyfsskdnvgkvtsgktcmyggitkheg
    nhfdngnlqnvlirvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnssp
    yetgyikfiesngntfwydmmpapgdkfdqskylmiykdnkmvdsksvkievhlttkng