PDB entry 1cjv

View 1cjv on RCSB PDB site
Description: complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with beta-l-2',3'-dideoxyatp, mg, and zn
Class: lyase/lyase/signaling protein
Keywords: complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme, lyase/lyase/signaling protein complex
Deposited on 1999-04-19, released 1999-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.203
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenylate cyclase, type v
    Species: Canis lupus familiaris [TaxId:9615]
    Gene: ADENYLYL CYCLASE TYPE V
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30803
      • engineered (112)
    Domains in SCOPe 2.07: d1cjva_
  • Chain 'B':
    Compound: adenylate cyclase, type II
    Species: Rattus norvegicus [TaxId:10116]
    Gene: ADENYLYL CYCLASE TYPE II
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cjvb_
  • Chain 'C':
    Compound: guanine nucleotide-binding protein g(s)
    Species: Bos taurus [TaxId:9913]
    Gene: GNAS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cjvc1, d1cjvc2
  • Heterogens: MG, CL, ZN, GSP, FOK, DAD, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cjvA (A:)
    memkadinakqedmmfhkiyiqkhdnvsilfadiegftslasqctaqelvmtlnelfarf
    dklaaenhclrikilgdcyycvsglpearadhahccvemgmdmieaislvremtgvnvnm
    rvgihsgrvhcgvlglrkwqfdvwsndvtlanhmeaggkagrihitkatlsylngdyeve
    pgcggernaylkehsietflilrctqkrkeekamiak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cjvA (A:)
    mmfhkiyiqkhdnvsilfadiegftslasqctaqelvmtlnelfarfdklaaenhclrik
    ilgdcyycvsglpearadhahccvemgmdmieaislvremtgvnvnmrvgihsgrvhcgv
    lglrkwqfdvwsndvtlanhmeaggkagrihitkatlsylngdyevepgcggernaylke
    hsietflil
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1cjvB (B:)
    rslkneelyhqsydcvcvmfasipdfkefytesdvnkegleclrllneiiadfddllskp
    kfsgvekiktigstymaatglsaipsqehaqeperqymhigtmvefayalvgkldainkh
    sfndfklrvginhgpviagvigaqkpqydiwgntvnvasrmdstgvldkiqvteetslil
    qtlgytctcrgiinvkgkgdlktyfvntemsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cjvB (B:)
    hqsydcvcvmfasipdfkefytesdvnkegleclrllneiiadfddllskpkfsgvekik
    tigstymaatglsarqymhigtmvefayalvgkldainkhsfndfklrvginhgpviagv
    igaqkpqydiwgntvnvasrmdstgvldkiqvteetslilqtlgytctcrgiinvkgkgd
    lktyfvnt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1cjvC (C:)
    mgclgnsktedqrneekaqreankkiekqlqkdkqvyrathrllllgagesgkstivkqm
    rilhvngfnggeggeedpnaksnsdgekatkvqdiknnlkeaietivaamsnlvppvela
    npenqfrvdyilsvmnvpdfdfppefyehakalwedegvracyersneyqlidcaqyfld
    kidvikqddyvpsdqdllrcrvltsgifetkfqvdkvnfhmfdvggqrderrkwiqcfnd
    vtaiifvvasssynmvirednqtnrlqealnlfksiwnnrwlrtisvilflnkqdllaek
    vlagkskiedyfpefaryttpedatpepgedprvtrakyfirdeflristasgdgrhycy
    phftcavdtenirrvfndcrdiiqrmhlrqyellgghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cjvC (C:)
    athrllllgagesgkstivkqmrilhvekatkvqdiknnlkeaietivaamsnlvppvel
    anpenqfrvdyilsvmnvpdfdfppefyehakalwedegvracyersneyqlidcaqyfl
    dkidvikqddyvpsdqdllrcrvltsgifetkfqvdkvnfhmfdvggqrderrkwiqcfn
    dvtaiifvvasssynmvirednqtnrlqealnlfksiwnnrwlrtisvilflnkqdllae
    kvlagkskiedyfpefaryttpedatpepgedprvtrakyfirdeflristasgdgrhyc
    yphftcavdtenirrvfndcrdiiqrmhl