PDB entry 1cju

View 1cju on RCSB PDB site
Description: complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with beta-l-2',3'-dideoxyatp and mg
Deposited on 1999-04-16, released 1999-08-31
The last revision prior to the SCOP 1.57 freeze date was dated 1999-11-26, with a file datestamp of 1999-11-25.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.222
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cjuA (A:)
    mmfhkiyiqkhdnvsilfadiegftslasqctaqelvmtlnelfarfdklaaenhclrik
    ilgdcyycvsglpearadhahccvemgmdmieaislvremtgvnvnmrvgihsgrvhcgv
    lglrkwqfdvwsndvtlanhmeaggkagrihitkatlsylngdyevepgcggernaylke
    hsietflil
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1cjuB (B:)
    yhqsydcvcvmfasipdfkefytesdvnkegleclrllneiiadfddllskpkfsgveki
    ktigstymaatglsaipsqehaqeperqymhigtmvefayalvgkldainkhsfndfklr
    vginhgpviagvigaqkpqydiwgntvnvasrmdstgvldkiqvteetslilqtlgytct
    crgiinvkgkgdlktyfvnt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cjuB (B:)
    yhqsydcvcvmfasipdfkefytesdvnkegleclrllneiiadfddllskpkfsgveki
    ktigstymaatglsarqymhigtmvefayalvgkldainkhsfndfklrvginhgpviag
    vigaqkpqydiwgntvnvasrmdstgvldkiqvteetslilqtlgytctcrgiinvkgkg
    dlktyfvnt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1cjuC (C:)
    athrllllgagesgkstivkqmrilhvngfnggeggeedpnaksnsdgekatkvqdiknn
    lkeaietivaamsnlvppvelanpenqfrvdyilsvmnvpdfdfppefyehakalwedeg
    vracyersneyqlidcaqyfldkidvikqddyvpsdqdllrcrvltsgifetkfqvdkvn
    fhmfdvggqrderrkwiqcfndvtaiifvvasssynmvirednqtnrlqealnlfksiwn
    nrwlrtisvilflnkqdllaekvlagkskiedyfpefaryttpedatpepgedprvtrak
    yfirdeflristasgdgrhycyphftcavdtenirrvfndcrdiiqrmhl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cjuC (C:)
    athrllllgagesgkstivkqmrilhvngekatkvqdiknnlkeaietivaamsnlvppv
    elanpenqfrvdyilsvmnvpdfdfppefyehakalwedegvracyersneyqlidcaqy
    fldkidvikqddyvpsdqdllrcrvltsgifetkfqvdkvnfhmfdvggqrderrkwiqc
    fndvtaiifvvasssynmvirednqtnrlqealnlfksiwnnrwlrtisvilflnkqdll
    aekvlagkskiedyfpefaryttpedatpepgedprvtrakyfirdeflristasgdgrh
    ycyphftcavdtenirrvfndcrdiiqrmhl