PDB entry 1cjg

View 1cjg on RCSB PDB site
Description: nmr structure of lac repressor hp62-dna complex
Deposited on 1999-04-14, released 2000-01-01
The last revision prior to the SCOP 1.57 freeze date was dated 2000-01-01, with a file datestamp of 1999-12-31.
Experiment type: NMR11
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1cjga_
  • Chain 'B':
    Domains in SCOP 1.57: d1cjgb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1cjgA (A:)
mkpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkq
sl

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1cjgB (B:)
mkpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkq
sl