PDB entry 1cje

View 1cje on RCSB PDB site
Description: adrenodoxin from bovine
Deposited on 1999-04-12, released 2000-01-21
The last revision prior to the SCOP 1.61 freeze date was dated 2000-01-21, with a file datestamp of 2000-01-20.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.233
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1cjea_
  • Chain 'B':
    Domains in SCOP 1.61: d1cjeb_
  • Chain 'C':
    Domains in SCOP 1.61: d1cjec_
  • Chain 'D':
    Domains in SCOP 1.61: d1cjed_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cjeA (A:)
    kitvhfinrdgetlttkgkigdslldvvvqnnldidgfgacegtlacstchlifeqhife
    kleaitdeendmldlaygltdrsrlgcqicltkamdnmtvrvpdav
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cjeB (B:)
    dkitvhfinrdgetlttkgkigdslldvvvqnnldidgfgacegtlacstchlifeqhif
    ekleaitdeendmldlaygltdrsrlgcqicltkamdnmtvrvpdav
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cjeC (C:)
    kitvhfinrdgetlttkgkigdslldvvvqnnldidgfgacegtlacstchlifeqhife
    kleaitdeendmldlaygltdrsrlgcqicltkamdnmtvrvpdav
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cjeD (D:)
    kitvhfinrdgetlttkgkigdslldvvvqnnldidgfgacegtlacstchlifeqhife
    kleaitdeendmldlaygltdrsrlgcqicltkamdnmtvrvpdavs