PDB entry 1civ

View 1civ on RCSB PDB site
Description: chloroplast nadp-dependent malate dehydrogenase from flaveria bidentis
Deposited on 1999-04-01, released 2000-04-05
The last revision prior to the SCOP 1.69 freeze date was dated 2000-04-05, with a file datestamp of 2000-04-05.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.205
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1civA (A:)
    svtssdqiqaplpakqkpecfgvfcltydlkaeeetkswkkiinvavsgaagmisnhllf
    klasgevfgpdqpislkllgsersfaalegvameledslypllrqvsigidpyeifqdae
    walligakprgpgmeradlldingqifaeqgkalnavaspnvkvmvvgnpcntnaliclk
    napnippknfhaltrldenrakcqlalkagvfydkvsnvtiwgnhsttqvpdflnakihg
    ipvtevirdrkwledeftnmvqtrggvlikkwgrssaastavsivdairslvtptpegdw
    fstgvytngnpygiaedivfsmpcrskgdgdyefvkdvifddylskkikksedellaekk
    cvahltgegiavcdlpedtmlpgem
    

    Sequence, based on observed residues (ATOM records): (download)
    >1civA (A:)
    lpakqkpecfgvfcltydlkaeeetkswkkiinvavsgaagmisnhllfklasgevfgpd
    qpislkllgsersfaalegvameledslypllrqvsigidpyeifqdaewalligakprg
    pgmeradlldingqifaeqgkalnavaspnvkvmvvgnpcntnaliclknapnippknfh
    altrldenrakcqlalkagvfydkvsnvtiwgnhsttqvpdflnakihgipvtevirdrk
    wledeftnmvqtrggvlikkwgrssaastavsivdairslvtptpegdwfstgvytngnp
    ygiaedivfsmpcrskgdgdyefvkdvifddylskkikksedellaekkcvahltgegia
    vcdlpedtmlpgem