PDB entry 1civ

View 1civ on RCSB PDB site
Description: chloroplast nadp-dependent malate dehydrogenase from flaveria bidentis
Class: oxidoreductase
Keywords: chloroplast, light activated, nadp-dependent, dehydrogenase, oxidoreductase
Deposited on 1999-04-01, released 2000-04-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.205
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nadp-malate dehydrogenase
    Species: Flaveria bidentis [TaxId:4224]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1civa1, d1civa2
  • Heterogens: NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1civA (A:)
    svtssdqiqaplpakqkpecfgvfcltydlkaeeetkswkkiinvavsgaagmisnhllf
    klasgevfgpdqpislkllgsersfaalegvameledslypllrqvsigidpyeifqdae
    walligakprgpgmeradlldingqifaeqgkalnavaspnvkvmvvgnpcntnaliclk
    napnippknfhaltrldenrakcqlalkagvfydkvsnvtiwgnhsttqvpdflnakihg
    ipvtevirdrkwledeftnmvqtrggvlikkwgrssaastavsivdairslvtptpegdw
    fstgvytngnpygiaedivfsmpcrskgdgdyefvkdvifddylskkikksedellaekk
    cvahltgegiavcdlpedtmlpgem
    

    Sequence, based on observed residues (ATOM records): (download)
    >1civA (A:)
    lpakqkpecfgvfcltydlkaeeetkswkkiinvavsgaagmisnhllfklasgevfgpd
    qpislkllgsersfaalegvameledslypllrqvsigidpyeifqdaewalligakprg
    pgmeradlldingqifaeqgkalnavaspnvkvmvvgnpcntnaliclknapnippknfh
    altrldenrakcqlalkagvfydkvsnvtiwgnhsttqvpdflnakihgipvtevirdrk
    wledeftnmvqtrggvlikkwgrssaastavsivdairslvtptpegdwfstgvytngnp
    ygiaedivfsmpcrskgdgdyefvkdvifddylskkikksedellaekkcvahltgegia
    vcdlpedtmlpgem