PDB entry 1cip

View 1cip on RCSB PDB site
Description: gi-alpha-1 subunit of guanine nucleotide-binding protein complexed with a gtp analogue
Deposited on 1999-04-05, released 1999-04-09
The last revision prior to the SCOP 1.55 freeze date was dated 1999-12-18, with a file datestamp of 1999-12-17.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.213
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cipA (A:)
    revkllllgagesgkstivkqmkiiheagyseeeckqykavvysntiqsiiaiiramgrl
    kidfgdaaraddarqlfvlagaaeegfmtaelagvikrlwkdsgvqacfnrsreyqlnds
    aayylndldriaqpnyiptqqdvlrtrvkttgivethftfkdlhfkmfdvggqrserkkw
    ihcfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilflnkk
    dlfeekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdtkn
    vqfvfdavtdviiknn