PDB entry 1cih

View 1cih on RCSB PDB site
Description: structural and functional effects of multiple mutations at distal sites in cytochrome c
Deposited on 1994-09-26, released 1995-01-26
The last revision prior to the SCOP 1.55 freeze date was dated 1995-07-20, with a file datestamp of 1995-08-14.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.2
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1cih__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cih_ (-)
    tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgahsgqaegysytdaiikk
    nvlwdennmseyltnpkkyipgtkmasgglkkekdrndlitylkkaae