PDB entry 1cif

View 1cif on RCSB PDB site
Description: structural and functional effects of multiple mutations at distal sites in cytochrome c
Deposited on 1994-09-26, released 1995-01-26
The last revision prior to the SCOP 1.63 freeze date was dated 1995-07-20, with a file datestamp of 1995-08-14.
Experiment type: -
Resolution: 1.9 Å
R-factor: 0.199
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.63: d1cif__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cif_ (-)
  tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgahsgqaegysytdanikk
  nvlwdennmseyltnpkkyipgtkmasgglkkekdrndlitylkkaae