PDB entry 1cid

View 1cid on RCSB PDB site
Description: crystal structure of domains 3 & 4 of rat cd4 and their relationship to the nh2-terminal domains
Class: T-cell surface glycoprotein
Keywords: T-cell surface glycoprotein
Deposited on 1993-01-28, released 1993-07-15
The last revision prior to the SCOP 1.75 freeze date was dated 1993-07-15, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.233
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: t cell surface glycoprotein cd4
    Species: Rattus norvegicus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1cida1, d1cida2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cidA (A:)
    tsitayksegesaefsfplnlgeeslqgelrwkaekapssqswitfslknqkvsvqksts
    npkfqlsetlpltlqipqvslqfagsgnltltldrgilyqevnlvvmkvtqpdsntltce
    vmgptspkmrlilkqenqearvsrqekviqvqapeagvwqcllsegeevkmdskiqv