PDB entry 1cic

View 1cic on RCSB PDB site
Description: idiotope-anti-idiotope fab-fab complex; d1.3-e225
Deposited on 1999-03-31, released 1999-04-19
The last revision prior to the SCOP 1.63 freeze date was dated 1999-04-19, with a file datestamp of 1999-04-18.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.179
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cicA (A:)
    divmtqshkfmstsvgdrvsitckasqdvriavawyqqkpgqspklliywastrhtgvpd
    rftgsgsgtdftltisnvqsedladyfcqhcgsypftfgsgtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvldswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cicB (B:)
    qvqlqqpgselvrpgasvklsckasgytftnywmhwvkqrpgqglewigniypgsgdsny
    dekfkskatltvdtssstaymqlsgltsedsavyycarglafyfdhwgqgttltvssalt
    tppsvyplapgcgdttgssvtlgclvkgyfpepvtvtwnsgslsssvhtfpallqsglyt
    msssvtvpsstwpsetvtcsvahpassttvdkkleps
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cicC (C:)
    diqmtqspaslsasvgetvtitcrasgnihnylawyqqkqgkspqllvyytttladgvps
    rfsgsgsgtqyslkinslqpedfgsyycqhfwstprtfgggtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvldswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cicD (D:)
    qvqlkesgpglvapsqslsitctvsgfsltgygvnwvrqppgkglewlgmiwgdgntdyn
    salksrlsiskdnsksqvflkmnslhtddtaryycarerdyrldywgqgttltvssastt
    ppsvfplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytl
    sssvtvpssprpsetvtcnvahpasstkvdkkivprdc