PDB entry 1chv

View 1chv on RCSB PDB site
Description: elucidation of the solution structure of cardiotoxin analogue v from the taiwan cobra (naja naja atra) venom
Deposited on 1999-03-30, released 2000-03-30
The last revision prior to the SCOP 1.57 freeze date was dated 2000-03-30, with a file datestamp of 2000-03-30.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'S':
    Domains in SCOP 1.57: d1chvs_

PDB Chain Sequences:

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1chvS (S:)
    lkcnklvplfyktcpagknlcykmfmvsnkmvpvkrgcidvcpkssllvkyvccntdrcn