PDB entry 1chr

View 1chr on RCSB PDB site
Description: crystal structure of chloromuconate cycloisomerase from alcaligenes eutrophus jmp134 (pjp4) at 3 angstroms resolution
Class: isomerase
Keywords: isomerase
Deposited on 1993-08-20, released 1993-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-04-04, with a file datestamp of 2012-03-30.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.195
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chloromuconate cycloisomerase
    Species: Cupriavidus necator [TaxId:106590]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1chra3, d1chra4
  • Chain 'B':
    Compound: chloromuconate cycloisomerase
    Species: Cupriavidus necator [TaxId:106590]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1chrb3, d1chrb4
  • Heterogens: MN, CL

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1chrA (A:)
    mkidaieavivdvptkrpiqmsittvhqqsyvivrvyseglvgvgeggsvggpvwsaeca
    etikiiverylaphllgtdafnvsgalqtmaravtgnasakaavemalldlkaralgvsi
    aellggplrsaipiawtlasgdtkrdldsavemierrrhnrfkvklgfrspqddlihmea
    lsnslgskaylrvdvnqawdeqvasvyipelealgvelieqpvgrentqalrrlsdnnrv
    aimadeslstlasafdlardrsvdvfslklcnmggvsatqkiaavaeasgiasyggtmld
    stigtsvalqlystvpslpfgceligpfvladtlshepleirdyelqvptgvghgmtlde
    dkvrqyarvs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1chrB (B:)
    mkidaieavivdvptkrpiqmsittvhqqsyvivrvyseglvgvgeggsvggpvwsaeca
    etikiiverylaphllgtdafnvsgalqtmaravtgnasakaavemalldlkaralgvsi
    aellggplrsaipiawtlasgdtkrdldsavemierrrhnrfkvklgfrspqddlihmea
    lsnslgskaylrvdvnqawdeqvasvyipelealgvelieqpvgrentqalrrlsdnnrv
    aimadeslstlasafdlardrsvdvfslklcnmggvsatqkiaavaeasgiasyggtmld
    stigtsvalqlystvpslpfgceligpfvladtlshepleirdyelqvptgvghgmtlde
    dkvrqyarvs