PDB entry 1chi

View 1chi on RCSB PDB site
Description: structural studies of the roles of residues 82 and 85 at the interactive face of cytochrome c
Deposited on 1994-06-01, released 1994-12-20
The last revision prior to the SCOP 1.61 freeze date was dated 1995-03-08, with a file datestamp of 1995-03-23.
Experiment type: -
Resolution: 2 Å
R-factor: 0.185
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.61: d1chi__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1chi_ (-)
  tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
  nvlwdennmseyltnpkkyipgtkmayggakkekdrndlitylkkate