PDB entry 1ch7

View 1ch7 on RCSB PDB site
Description: recombinant sperm whale myoglobin h97f mutant (met)
Deposited on 1999-03-31, released 1999-04-09
The last revision prior to the SCOP 1.55 freeze date was dated 1999-04-09, with a file datestamp of 1999-04-09.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.155
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1ch7a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ch7A (A:)
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkkhgvtvltalgailkkkghheaelkplaqshatkfkipikylefiseaiihvlhsrh
pgnfgadaqgamnkalelfrkdiaakykelgyqg