PDB entry 1cgz

View 1cgz on RCSB PDB site
Description: chalcone synthase from alfalfa complexed with resveratrol
Class: transferase
Keywords: polyketide synthase, chalcone biosynthesis, transferase
Deposited on 1999-03-26, released 1999-08-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.171
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (chalcone synthase)
    Species: Medicago sativa [TaxId:3879]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cgza1, d1cgza2
  • Heterogens: STL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cgzA (A:)
    mvsvseirkaqraegpatilaigtanpancveqstypdfyfkitnsehktelkekfqrmc
    dksmikrrymylteeilkenpnvceymapsldarqdmvvvevprlgkeaavkaikewgqp
    kskithlivcttsgvdmpgadyqltkllglrpyvkrymmyqqgcfaggtvlrlakdlaen
    nkgarvlvvcsevtavtfrgpsdthldslvgqalfgdgaaalivgsdpvpeiekpifemv
    wtaqtiapdsegaidghlreagltfhllkdvpgivsknitkalveafeplgisdynsifw
    iahpggpaildqveqklalkpekmnatrevlseygnmssacvlfildemrkkstqnglkt
    tgeglewgvlfgfgpgltietvvlrsvai
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cgzA (A:)
    svseirkaqraegpatilaigtanpancveqstypdfyfkitnsehktelkekfqrmcdk
    smikrrymylteeilkenpnvceymapsldarqdmvvvevprlgkeaavkaikewgqpks
    kithlivcttsgvdmpgadyqltkllglrpyvkrymmyqqgcfaggtvlrlakdlaennk
    garvlvvcsevtavtfrgpsdthldslvgqalfgdgaaalivgsdpvpeiekpifemvwt
    aqtiapdsegaidghlreagltfhllkdvpgivsknitkalveafeplgisdynsifwia
    hpggpaildqveqklalkpekmnatrevlseygnmssacvlfildemrkkstqnglkttg
    eglewgvlfgfgpgltietvvlrsvai