PDB entry 1cgk

View 1cgk on RCSB PDB site
Description: chalcone synthase from alfalfa complexed with naringenin
Class: transferase
Keywords: polyketide synthase, chalcone biosynthesis, transferase
Deposited on 1999-03-25, released 1999-09-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: 0.161
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (chalcone synthase)
    Species: Medicago sativa [TaxId:3879]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cgka1, d1cgka2
  • Heterogens: NAR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cgkA (A:)
    mvsvseirkaqraegpatilaigtanpancveqstypdfyfkitnsehktelkekfqrmc
    dksmikrrymylteeilkenpnvceymapsldarqdmvvvevprlgkeaavkaikewgqp
    kskithlivcttsgvdmpgadyqltkllglrpyvkrymmyqqgcfaggtvlrlakdlaen
    nkgarvlvvcsevtavtfrgpsdthldslvgqalfgdgaaalivgsdpvpeiekpifemv
    wtaqtiapdsegaidghlreagltfhllkdvpgivsknitkalveafeplgisdynsifw
    iahpggpaildqveqklalkpekmnatrevlseygnmssacvlfildemrkkstqnglkt
    tgeglewgvlfgfgpgltietvvlrsvai
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cgkA (A:)
    svseirkaqraegpatilaigtanpancveqstypdfyfkitnsehktelkekfqrmcdk
    smikrrymylteeilkenpnvceymapsldarqdmvvvevprlgkeaavkaikewgqpks
    kithlivcttsgvdmpgadyqltkllglrpyvkrymmyqqgcfaggtvlrlakdlaennk
    garvlvvcsevtavtfrgpsdthldslvgqalfgdgaaalivgsdpvpeiekpifemvwt
    aqtiapdsegaidghlreagltfhllkdvpgivsknitkalveafeplgisdynsifwia
    hpggpaildqveqklalkpekmnatrevlseygnmssacvlfildemrkkstqnglkttg
    eglewgvlfgfgpgltietvvlrsvai