PDB entry 1cg2

View 1cg2 on RCSB PDB site
Description: carboxypeptidase g2
Deposited on 1996-12-20, released 1997-12-24
The last revision prior to the SCOP 1.65 freeze date was dated 1997-12-24, with a file datestamp of 1997-12-24.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.196
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cg2A (A:)
    alaqkrdnvlfqaatdeqpaviktleklvnietgtgdaegiaaagnfleaelknlgftvt
    rsksaglvvgdnivgkikgrggknlllmshmdtvylkgilakapfrvegdkaygpgiadd
    kggnavilhtlkllkeygvrdygtitvlfntdeekgsfgsrdliqeeakladyvlsfept
    sagdeklslgtsgiayvqvnitgkashagaapelgvnalveasdlvlrtmniddkaknlr
    fnwtiakagnvsniipasatlnadvryarnedfdaamktleeraqqkklpeadvkvivtr
    grpafnageggkklvdkavayykeaggtlgveertgggtdaayaalsgkpvieslglpgf
    gyhsdkaeyvdisaiprrlymaarlimdlgagk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cg2A (A:)
    qkrdnvlfqaatdeqpaviktleklvnietgtgdaegiaaagnfleaelknlgftvtrsk
    saglvvgdnivgkikgrggknlllmshmdtvylkgilakapfrvegdkaygpgiaddkgg
    navilhtlkllkeygvrdygtitvlfntdeekgsfgsrdliqeeakladyvlsfeptsag
    deklslgtsgiayvqvnitgkashagaapelgvnalveasdlvlrtmniddkaknlrfnw
    tiakagnvsniipasatlnadvryarnedfdaamktleeraqqkklpeadvkvivtrgrp
    afnageggkklvdkavayykeaggtlgveertgggtdaayaalsgkpvieslglpgfgyh
    sdkaeyvdisaiprrlymaarlimdlgag
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1cg2B (B:)
    alaqkrdnvlfqaatdeqpaviktleklvnietgtgdaegiaaagnfleaelknlgftvt
    rsksaglvvgdnivgkikgrggknlllmshmdtvylkgilakapfrvegdkaygpgiadd
    kggnavilhtlkllkeygvrdygtitvlfntdeekgsfgsrdliqeeakladyvlsfept
    sagdeklslgtsgiayvqvnitgkashagaapelgvnalveasdlvlrtmniddkaknlr
    fnwtiakagnvsniipasatlnadvryarnedfdaamktleeraqqkklpeadvkvivtr
    grpafnageggkklvdkavayykeaggtlgveertgggtdaayaalsgkpvieslglpgf
    gyhsdkaeyvdisaiprrlymaarlimdlgagk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cg2B (B:)
    qkrdnvlfqaatdeqpaviktleklvnietgtgdaegiaaagnfleaelknlgftvtrsk
    saglvvgdnivgkikgrggknlllmshmdtvylkgilakapfrvegdkaygpgiaddkgg
    navilhtlkllkeygvrdygtitvlfntdeekgsfgsrdliqeeakladyvlsfeptsag
    deklslgtsgiayvqvnitgkashagaapelgvnalveasdlvlrtmniddkaknlrfnw
    tiakagnvsniipasatlnadvryarnedfdaamktleeraqqkklpeadvkvivtrgrp
    afnageggkklvdkavayykeaggtlgveertgggtdaayaalsgkpvieslglpgfgyh
    sdkaeyvdisaiprrlymaarlimdlgag
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1cg2C (C:)
    alaqkrdnvlfqaatdeqpaviktleklvnietgtgdaegiaaagnfleaelknlgftvt
    rsksaglvvgdnivgkikgrggknlllmshmdtvylkgilakapfrvegdkaygpgiadd
    kggnavilhtlkllkeygvrdygtitvlfntdeekgsfgsrdliqeeakladyvlsfept
    sagdeklslgtsgiayvqvnitgkashagaapelgvnalveasdlvlrtmniddkaknlr
    fnwtiakagnvsniipasatlnadvryarnedfdaamktleeraqqkklpeadvkvivtr
    grpafnageggkklvdkavayykeaggtlgveertgggtdaayaalsgkpvieslglpgf
    gyhsdkaeyvdisaiprrlymaarlimdlgagk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cg2C (C:)
    qkrdnvlfqaatdeqpaviktleklvnietgtgdaegiaaagnfleaelknlgftvtrsk
    saglvvgdnivgkikgrggknlllmshmdtvylkgilakapfrvegdkaygpgiaddkgg
    navilhtlkllkeygvrdygtitvlfntdeekgsfgsrdliqeeakladyvlsfeptsag
    deklslgtsgiayvqvnitgkashagaapelgvnalveasdlvlrtmniddkaknlrfnw
    tiakagnvsniipasatlnadvryarnedfdaamktleeraqqkklpeadvkvivtrgrp
    afnageggkklvdkavayykeaggtlgveertgggtdaayaalsgkpvieslglpgfgyh
    sdkaeyvdisaiprrlymaarlimdlgag
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1cg2D (D:)
    alaqkrdnvlfqaatdeqpaviktleklvnietgtgdaegiaaagnfleaelknlgftvt
    rsksaglvvgdnivgkikgrggknlllmshmdtvylkgilakapfrvegdkaygpgiadd
    kggnavilhtlkllkeygvrdygtitvlfntdeekgsfgsrdliqeeakladyvlsfept
    sagdeklslgtsgiayvqvnitgkashagaapelgvnalveasdlvlrtmniddkaknlr
    fnwtiakagnvsniipasatlnadvryarnedfdaamktleeraqqkklpeadvkvivtr
    grpafnageggkklvdkavayykeaggtlgveertgggtdaayaalsgkpvieslglpgf
    gyhsdkaeyvdisaiprrlymaarlimdlgagk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cg2D (D:)
    qkrdnvlfqaatdeqpaviktleklvnietgtgdaegiaaagnfleaelknlgftvtrsk
    saglvvgdnivgkikgrggknlllmshmdtvylkgilakapfrvegdkaygpgiaddkgg
    navilhtlkllkeygvrdygtitvlfntdeekgsfgsrdliqeeakladyvlsfeptsag
    deklslgtsgiayvqvnitgkashagaapelgvnalveasdlvlrtmniddkaknlrfnw
    tiakagnvsniipasatlnadvryarnedfdaamktleeraqqkklpeadvkvivtrgrp
    afnageggkklvdkavayykeaggtlgveertgggtdaayaalsgkpvieslglpgfgyh
    sdkaeyvdisaiprrlymaarlimdlgag