PDB entry 1cfv

View 1cfv on RCSB PDB site
Description: monoclonal antibody fragment fv4155 from e. coli
Class: immunoglobulin
Keywords: fv fragment, steroid hormone, fine specificity, immunoglobulin
Deposited on 1997-04-11, released 1997-10-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.178
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: monoclonal antibody fv4155
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1CFV (0-118)
    Domains in SCOPe 2.04: d1cfvh_
  • Chain 'L':
    Compound: monoclonal antibody fv4155
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01631 (0-112)
      • conflict (1-3)
      • conflict (6)
      • conflict (8)
      • conflict (18)
      • conflict (30-31)
      • conflict (33-35)
      • conflict (38)
      • conflict (44)
      • conflict (51)
      • conflict (83)
      • conflict (89)
      • conflict (95-96)
      • conflict (100)
      • conflict (104)
    Domains in SCOPe 2.04: d1cfvl_
  • Heterogens: ZN, E3G, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cfvH (H:)
    qvqlqesggglvnlggsmtlscvasgftfntyymswvrqtpektlelvaainsdgepiyy
    pdtlkgrvtisrdnakktlylqmsslnfedtalyycarlnyavygmdywgqgttvtvss
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cfvL (L:)
    dieltqsppslpvslgdqvsiscrssqslvsnnrrnylhwylqkpgqspklviykvsnrf
    sgvpdrfsgsgsgtdftlkisrvaaedlglyfcsqsshvpltfgsgtkleikr