PDB entry 1cfv
View 1cfv on RCSB PDB site
Description: monoclonal antibody fragment fv4155 from e. coli
Class: immunoglobulin
Keywords: fv fragment, steroid hormone, fine specificity, immunoglobulin
Deposited on
1997-04-11, released
1997-10-15
The last revision prior to the SCOPe 2.03 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.178
AEROSPACI score: 0.4
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'H':
Compound: monoclonal antibody fv4155
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d1cfvh_ - Chain 'L':
Compound: monoclonal antibody fv4155
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
- Uniprot P01631 (0-112)
- conflict (1-3)
- conflict (6)
- conflict (8)
- conflict (18)
- conflict (30-31)
- conflict (33-35)
- conflict (38)
- conflict (44)
- conflict (51)
- conflict (83)
- conflict (89)
- conflict (95-96)
- conflict (100)
- conflict (104)
Domains in SCOPe 2.03: d1cfvl_ - Heterogens: ZN, E3G, HOH
PDB Chain Sequences:
- Chain 'H':
Sequence; same for both SEQRES and ATOM records: (download)
>1cfvH (H:)
qvqlqesggglvnlggsmtlscvasgftfntyymswvrqtpektlelvaainsdgepiyy
pdtlkgrvtisrdnakktlylqmsslnfedtalyycarlnyavygmdywgqgttvtvss
- Chain 'L':
Sequence; same for both SEQRES and ATOM records: (download)
>1cfvL (L:)
dieltqsppslpvslgdqvsiscrssqslvsnnrrnylhwylqkpgqspklviykvsnrf
sgvpdrfsgsgsgtdftlkisrvaaedlglyfcsqsshvpltfgsgtkleikr