PDB entry 1cfv

View 1cfv on RCSB PDB site
Description: monoclonal antibody fragment fv4155 from e. coli
Deposited on 1997-04-11, released 1997-10-15
The last revision prior to the SCOP 1.55 freeze date was dated 1997-10-15, with a file datestamp of 1997-10-15.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.178
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Domains in SCOP 1.55: d1cfvh_
  • Chain 'L':
    Domains in SCOP 1.55: d1cfvl_

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cfvH (H:)
    qvqlqesggglvnlggsmtlscvasgftfntyymswvrqtpektlelvaainsdgepiyy
    pdtlkgrvtisrdnakktlylqmsslnfedtalyycarlnyavygmdywgqgttvtvss
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cfvL (L:)
    dieltqsppslpvslgdqvsiscrssqslvsnnrrnylhwylqkpgqspklviykvsnrf
    sgvpdrfsgsgsgtdftlkisrvaaedlglyfcsqsshvpltfgsgtkleikr