PDB entry 1cft

View 1cft on RCSB PDB site
Description: anti-p24 (hiv-1) fab fragment cb41 complexed with an epitope-unrelated d-peptide
Deposited on 1999-03-19, released 1999-03-31
The last revision prior to the SCOP 1.59 freeze date was dated 1999-04-28, with a file datestamp of 1999-05-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.237
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cftA (A:)
    dikmtqspssmytslgervtitckasqdinsfltwflqkpgkspktliyranrlmigvps
    rfsgsgsgqtysltissleyedmgiyyclqyddfpltfgagtkldlkradaaptvsifpp
    sseqltsggasvvcflnnfypkeinvkwkidgserqngvldswteqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cftB (B:)
    qdqlqqsgaelvrpgasvklsckalgyiftdyeihwvkqtpvhglewiggihpgssgtay
    nqkfkgkatltadkssttafmelssltsedsavyyctrkdywgqgtlvtvsaakttapsv
    yplvpvcggttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpallqsglytlsssv
    tvtsntwpsqtitcnvahpasstkvdkkieprv