PDB entry 1cf2

View 1cf2 on RCSB PDB site
Description:
Deposited on 1999-03-24, released 2000-03-24
The last revision prior to the SCOP 1.55 freeze date was dated 2000-03-29, with a file datestamp of .
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.194
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'O':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1cf2o1, d1cf2o2
  • Chain 'P':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1cf2p1, d1cf2p2
  • Chain 'Q':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1cf2q1, d1cf2q2
  • Chain 'R':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1cf2r1, d1cf2r2

PDB Chain Sequences:

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cf2O (O:)
    mkavaingygtvgkrvadaiaqqddmkvigvsktrpdfearmalkkgydlyvaipervkl
    fekagievagtvddmldeadividctpegigaknlkmykekgikaifqggekhediglsf
    nslsnyeesygkdytrvvscnttglcrtlkplhdsfgikkvravivrrgadpaqvskgpi
    naiipnppklpshhgpdvktvldinidtmavivpttlmhqhnvmveveetptvddiidvf
    edtprvilisaedgltstaeimeyakelgrsrndlfeipvwresitvvdneiyymqavhq
    esdivpenvdavrailemeedkyksinktnkamnil
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cf2P (P:)
    mkavaingygtvgkrvadaiaqqddmkvigvsktrpdfearmalkkgydlyvaipervkl
    fekagievagtvddmldeadividctpegigaknlkmykekgikaifqggekhediglsf
    nslsnyeesygkdytrvvscnttglcrtlkplhdsfgikkvravivrrgadpaqvskgpi
    naiipnppklpshhgpdvktvldinidtmavivpttlmhqhnvmveveetptvddiidvf
    edtprvilisaedgltstaeimeyakelgrsrndlfeipvwresitvvdneiyymqavhq
    esdivpenvdavrailemeedkyksinktnkamnil
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cf2Q (Q:)
    mkavaingygtvgkrvadaiaqqddmkvigvsktrpdfearmalkkgydlyvaipervkl
    fekagievagtvddmldeadividctpegigaknlkmykekgikaifqggekhediglsf
    nslsnyeesygkdytrvvscnttglcrtlkplhdsfgikkvravivrrgadpaqvskgpi
    naiipnppklpshhgpdvktvldinidtmavivpttlmhqhnvmveveetptvddiidvf
    edtprvilisaedgltstaeimeyakelgrsrndlfeipvwresitvvdneiyymqavhq
    esdivpenvdavrailemeedkyksinktnkamnil
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cf2R (R:)
    mkavaingygtvgkrvadaiaqqddmkvigvsktrpdfearmalkkgydlyvaipervkl
    fekagievagtvddmldeadividctpegigaknlkmykekgikaifqggekhediglsf
    nslsnyeesygkdytrvvscnttglcrtlkplhdsfgikkvravivrrgadpaqvskgpi
    naiipnppklpshhgpdvktvldinidtmavivpttlmhqhnvmveveetptvddiidvf
    edtprvilisaedgltstaeimeyakelgrsrndlfeipvwresitvvdneiyymqavhq
    esdivpenvdavrailemeedkyksinktnkamnil