PDB entry 1cet

View 1cet on RCSB PDB site
Description: chloroquine binds in the cofactor binding site of plasmodium falciparum lactate dehydrogenase.
Class: oxidoreductase
Keywords: oxidoreductase, tricarboxylic acid cycle, inhibitor
Deposited on 1999-03-10, released 1999-03-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.154
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (l-lactate dehydrogenase)
    Species: Plasmodium falciparum [TaxId:5833]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q27743 (Start-315)
      • conflict (72)
    Domains in SCOPe 2.06: d1ceta1, d1ceta2
  • Heterogens: CLQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cetA (A:)
    mapkakivlvgsgmiggvmatlivqknlgdvvlfdivknmphgkaldtshtnvmaysnck
    vsgsntyddlagsdvvivtagftkapgksdkewnrldllplnnkimieigghikkncpna
    fiivvtnpvdvmvqllhqhsgvpknkiiglggvldtsrlkyyisqklnvcprdvnahivg
    ahgnkmvllkryitvggiplqefinnklisdaeleaifdrtvntaleivnlhaspyvapa
    aaiiemaesylkdlkkvlicstllegqyghsdifggtpvvlgangveqvielqlnseeka
    kfdeaiaetkrmkala
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cetA (A:)
    apkakivlvgsgmiggvmatlivqknlgdvvlfdivknmphgkaldtshtnvmaysnckv
    sgsntyddlagsdvvivtagftnrldllplnnkimieigghikkncpnafiivvtnpvdv
    mvqllhqhsgvpknkiiglggvldtsrlkyyisqklnvcprdvnahivgahgnkmvllkr
    yitvggiplqefinnklisdaeleaifdrtvntaleivnlhaspyvapaaaiiemaesyl
    kdlkkvlicstllegqyghsdifggtpvvlgangveqvielqlnseekakfdeaiaetkr
    mkala