PDB entry 1cej

View 1cej on RCSB PDB site
Description: solution structure of an egf module pair from the plasmodium falciparum merozoite surface protein 1
Class: surface protein
Keywords: egf-like domain, extracellular, modular protein, surface antigen, malaria vaccine component, surface protein
Deposited on 1999-03-08, released 1999-05-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (merozoite surface protein 1)
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: MSP-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ceja1, d1ceja2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cejA (A:)
    nisqhqcvkkqcpqnsgcfrhldereeckcllnykqegdkcvenpnptcnennggcdada
    kcteedsgsngkkitcectkpdsyplfdgifcsssn