PDB entry 1cej

View 1cej on RCSB PDB site
Description: solution structure of an egf module pair from the plasmodium falciparum merozoite surface protein 1
Deposited on 1999-03-08, released 1999-05-28
The last revision prior to the SCOP 1.55 freeze date was dated 1999-05-28, with a file datestamp of 1999-05-27.
Experiment type: NMR32
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1cejA (A:)
nisqhqcvkkqcpqnsgcfrhldereeckcllnykqegdkcvenpnptcnennggcdada
kcteedsgsngkkitcectkpdsyplfdgifcsssn