PDB entry 1cef

View 1cef on RCSB PDB site
Description: cefotaxime complexed with the streptomyces r61 dd-peptidase
Class: hydrolase-transpeptidase
Keywords: d-amino acid peptidase, penicillin target, hydrolase-transpeptidase
Deposited on 1995-01-12, released 1996-10-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: 0.172
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: d-alanyl-d-alanine carboxypeptidase transpeptidase
    Species: Streptomyces sp. [TaxId:31952]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1cefa_
  • Heterogens: CEF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cefA (A:)
    adlpapddtglqavlhtalsqgapgamvrvddngtihqlsegvadratgraitttdrfrv
    gsvtksfsavvllqlvdegkldldasvntylpgllpddritvrqvmshrsglydytndmf
    aqtvpgfesvrnkvfsyqdlitlslkhgvtnapgaaysysntnfvvagmliekltghsva
    teyqnriftplnltdtfyvhpdtvipgthangyltpdeaggalvdsteqtvswaqsagav
    isstqdldtffsalmsgqlmsaaqlaqmqqwttvnstqgyglglrrrdlscgisvyghtg
    tvqgyytyafaskdgkrsvtalantsnnvnvlntmartlesafcgkptt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cefA (A:)
    adlpapddtglqavlhtalsqgapgamvrvddngtihqlsegvadratgraitttdrfrv
    gsvtksfsavvllqlvdegkldldasvntylpgllpddritvrqvmshrsglydytndmf
    aqtvpgfesvrnkvfsyqdlitlslkhgvtnapgaaysysntnfvvagmliekltghsva
    teyqnriftplnltdtfyvhpdtvipgthangyltpdeaggalvdsteqtvswaqsagav
    isstqdldtffsalmsgqlmsaaqlaqmqqwttvnstqgyglglrrrdlscgisvyghtg
    tvqgyytyafaskdgkrsvtalantsnnvnvlntmartlesafcgkp