PDB entry 1cea

View 1cea on RCSB PDB site
Description: the structure of the non-covalent complex of recombinant kringle 1 domain of human plasminogen with eaca (epsilon-aminocaproic acid)
Deposited on 1995-12-03, released 1996-04-03
The last revision prior to the SCOP 1.59 freeze date was dated 1996-04-03, with a file datestamp of 1996-04-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.168
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1ceaa_
  • Chain 'B':
    Domains in SCOP 1.59: d1ceab_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ceaA (A:)
    ecktgngknyrgtmsktkngitcqkwsstsphrprfspathpsegleenycrnpdndpqg
    pwcyttdpekrydycdilec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ceaB (B:)
    ecktgngknyrgtmsktkngitcqkwsstsphrprfspathpsegleenycrnpdndpqg
    pwcyttdpekrydycdilec