PDB entry 1ce3

View 1ce3 on RCSB PDB site
Description: putative ancestral protein encoded by a single sequence repeat of the multidomain proteinase inhibitor from nicotiana alata
Deposited on 1999-03-14, released 1999-03-27
The last revision prior to the SCOP 1.67 freeze date was dated 1999-09-01, with a file datestamp of 1999-08-31.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1ce3a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ce3A (A:)
    mkactlncdpriaygvcprseekkndrictnccagtkgckyfsddgtfvceges