PDB entry 1cdk

View 1cdk on RCSB PDB site
Description: camp-dependent protein kinase catalytic subunit (e.c.2.7.1.37) (protein kinase a) complexed with protein kinase inhibitor peptide fragment 5-24 (pki(5-24) isoelectric variant ca) and mn2+ adenylyl imidodiphosphate (mnamp-pnp) at ph 5.6 and 7c and 4c
Deposited on 1994-07-04, released 1995-10-15
The last revision prior to the SCOP 1.55 freeze date was dated 1995-10-15, with a file datestamp of 1995-10-16.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.197
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1cdka_
  • Chain 'B':
    Domains in SCOP 1.55: d1cdkb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cdkA (A:)
    kgseqesvkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlvkhketgn
    hfamkildkqkvvklkqiehtlnekrilqavnfpflvkleysfkdnsnlymvmeyvpgge
    mfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgf
    akrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiy
    ekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkdgvndiknhkwfattdwiaiyq
    rkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cdkB (B:)
    kgseqesvkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlvkhketgn
    hfamkildkqkvvklkqiehtlnekrilqavnfpflvkleysfkdnsnlymvmeyvpgge
    mfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgf
    akrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiy
    ekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkdgvndiknhkwfattdwiaiyq
    rkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef