PDB entry 1cdb

View 1cdb on RCSB PDB site
Description: structure of the glycosylated adhesion domain of human t lymphocyte glycoprotein cd2
Deposited on 1993-09-15, released 1994-01-31
The last revision prior to the SCOP 1.55 freeze date was dated 1994-10-15, with a file datestamp of 1994-10-26.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1cdb__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cdb_ (-)
    keitnaletwgalgqdinldipsfqmsddiddikwektsdkkkiaqfrkeketfkekdty
    klfkngtlkikhlktddqdiykvsiydtkgknvlekifdlkiqer