PDB entry 1cd9

View 1cd9 on RCSB PDB site
Description: 2:2 complex of g-csf with its receptor
Class: cytokine
Keywords: class1 cytokine, hematopoietic receptor, signal transduction, cytokine
Deposited on 1999-03-08, released 2000-03-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.237
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (granulocyte colony-stimulating factor)
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1cd9a_
  • Chain 'B':
    Compound: protein (g-csf receptor)
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1cd9b1, d1cd9b2
  • Chain 'C':
    Compound: protein (granulocyte colony-stimulating factor)
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1cd9c_
  • Chain 'D':
    Compound: protein (g-csf receptor)
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1cd9d1, d1cd9d2
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cd9A (A:)
    mtplgpasslpqsfllkcleqvrkiqgdgaalqeklcatyklchpeelvllghslgipwa
    plsscpsqalqlagclsqlhsglflyqgllqalegispelgptldtlqldvadfattiwq
    qmeelgmapalqptqgampafasafqrraggvlvashlqsflevsyrvlrhlaqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cd9A (A:)
    gpasslpqsfllkcleqvrkiqgdgaalqeklcatyklchpeelvllghslgipwaplss
    cpsqalqlagclsqlhsglflyqgllqalegispelgptldtlqldvadfattiwqqmee
    lgmapalqptqgampafasafqrraggvlvashlqsflevsyrvlrhlaqp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1cd9B (B:)
    agyppaspsnlsclmhlttnslvcqwepgpethlptsfilksfrsradcqyqgdtipdcv
    akkrqnncsiprknlllyqymaiwvqaenmlgssespklcldpmdvvkleppmlqaldig
    pdvvshqpgclwlswkpwkpseymeqecelryqpqlkganwtlvfhlpsskdqfelcglh
    qapvytlqmrcirsslpgfwspwspglqlrptmka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cd9B (B:)
    agyppaspsnlsclmhlttnslvcqwepgpethlptsfilksfrsradcqyqgdtipdcv
    akkrqnncsiprknlllyqymaiwvqaenmlgssespklcldpmdvvkleppmlqaldiq
    pgclwlswkpwkpseymeqecelryqpqlkganwtlvfhlpsskdqfelcglhqapvytl
    qmrcirsslpgfwspwspglqlrptm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1cd9C (C:)
    mtplgpasslpqsfllkcleqvrkiqgdgaalqeklcatyklchpeelvllghslgipwa
    plsscpsqalqlagclsqlhsglflyqgllqalegispelgptldtlqldvadfattiwq
    qmeelgmapalqptqgampafasafqrraggvlvashlqsflevsyrvlrhlaqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cd9C (C:)
    asslpqsfllkcleqvrkiqgdgaalqeklcatyklchpeelvllghslgipwaplsscp
    sqalqlagclsqlhsglflyqgllqalegispelgptldtlqldvadfattiwqqmeelg
    mapalqptqgampafasafqrraggvlvashlqsflevsyrvlrhlaqp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1cd9D (D:)
    agyppaspsnlsclmhlttnslvcqwepgpethlptsfilksfrsradcqyqgdtipdcv
    akkrqnncsiprknlllyqymaiwvqaenmlgssespklcldpmdvvkleppmlqaldig
    pdvvshqpgclwlswkpwkpseymeqecelryqpqlkganwtlvfhlpsskdqfelcglh
    qapvytlqmrcirsslpgfwspwspglqlrptmka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cd9D (D:)
    gyppaspsnlsclmhlttnslvcqwepgpethlptsfilksfrsradcqyqgdtipdcva
    kkrqnncsiprknlllyqymaiwvqaenmlgssespklcldpmdvvkleppmlqaldqpg
    clwlswkpwkpseymeqecelryqpqlkganwtlvfhlpsskdqfelcglhqapvytlqm
    rcirsslpgfwspwspglqlrptm