PDB entry 1cd0

View 1cd0 on RCSB PDB site
Description: structure of human lamda-6 light chain dimer jto
Deposited on 1999-03-05, released 2000-03-06
The last revision prior to the SCOP 1.63 freeze date was dated 2000-03-06, with a file datestamp of 2000-03-06.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.184
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1cd0a_
  • Chain 'B':
    Domains in SCOP 1.63: d1cd0b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cd0A (A:)
    nfmlnqphsvsespgktvtisctrssgnidsnyvqwyqqrpgsapitviyednqrpsgvp
    drfagsidrssnsasltisglktedeadyycqsydarnvvfgggtrltvlg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cd0B (B:)
    nfmlnqphsvsespgktvtisctrssgnidsnyvqwyqqrpgsapitviyednqrpsgvp
    drfagsidrssnsasltisglktedeadyycqsydarnvvfgggtrltvl