PDB entry 1ccr

View 1ccr on RCSB PDB site
Description: structure of rice ferricytochrome c at 2.0 angstroms resolution
Class: electron transport(cytochrome)
Keywords: electron transport(cytochrome)
Deposited on 1983-03-14, released 1983-04-21
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.19
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c
    Species: Oryza sativa
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00055 (0-110)
      • conflict (59)
    Domains in SCOP 1.75: d1ccra_
  • Heterogens: ACE, HEM, TML, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ccrA (A:)
    asfseappgnpkagekifktkcaqchtvdkgaghkqgpnlnglfgrqsgttpgysystad
    knmaviweentlydyllnpkkyipgtkmvfpglkkpqeradlisylkeats