PDB entry 1ccg

View 1ccg on RCSB PDB site
Description: construction of a bis-aquo heme enzyme and replacement with exogenous ligand
Class: oxidoreductase(h2o2(a))
Keywords: oxidoreductase(h2o2(a))
Deposited on 1994-05-04, released 1994-07-31
The last revision prior to the SCOP 1.73 freeze date was dated 1994-07-31, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 2.1 Å
R-factor: 0.19
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c peroxidase
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00431 (0-290)
      • conflict (49)
      • conflict (148)
      • conflict (171)
    Domains in SCOP 1.73: d1ccga_
  • Heterogens: HEM, IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ccgA (A:)
    lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdnt
    ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
    ipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgagalgkthlk
    nsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpk
    ylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl