PDB entry 1ccf

View 1ccf on RCSB PDB site
Description: how an epidermal growth factor (egf)-like domain binds calcium-high resolution nmr structure of the calcium form of the nh2-terminal egf-like domain in coagulation factor x
Class: coagulation factor
Keywords: coagulation factor
Deposited on 1993-05-19, released 1994-05-31
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: NMR15
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: coagulation factor x
    Species: Bos taurus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1ccfa_
  • Heterogens: HYD

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ccfA (A:)
    kdgdqceghpclnqghckdgigdytctcaegfegkncefstr