PDB entry 1ccf

View 1ccf on RCSB PDB site
Description: how an epidermal growth factor (egf)-like domain binds calcium-high resolution nmr structure of the calcium form of the nh2-terminal egf- like domain in coagulation factor x
Deposited on 1993-05-19, released 1994-05-31
The last revision prior to the SCOP 1.61 freeze date was dated 1994-05-31, with a file datestamp of 1994-06-07.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.61: d1ccf__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ccf_ (-)
    kdgdqceghpclnqghckdgigdytctcaegfegkncefstr