PDB entry 1cc5

View 1cc5 on RCSB PDB site
Description: crystal structure of azotobacter cytochrome c5 at 2.5 angstroms resolution
Class: electron transport (heme protein)
Keywords: electron transport (heme protein)
Deposited on 1984-08-10, released 1984-10-29
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.29
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytochrome c5
  Species: Azotobacter vinelandii
  Database cross-references and differences (RAF-indexed):
  • Uniprot P11732 (0-82)
  Domains in SCOP 1.75: d1cc5a_
• Heterogens: HEM

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cc5A (A:)
  gggarsgddvvakycnachgtgllnapkvgdsaawktradakggldgllaqslsglnamp
  pkgtcadcsddelkaaigkmsgl