PDB entry 1cbv

View 1cbv on RCSB PDB site
Description: an autoantibody to single-stranded dna: comparison of the three- dimensional structures of the unliganded fab and a deoxynucleotide- fab complex
Deposited on 1993-03-16, released 1994-01-31
The last revision prior to the SCOP 1.55 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.66 Å
R-factor: 0.191
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cbvH (H:)
    evqpvetggglvqpkgslklscaasgfsfntnamnwvrqapgkglewvarirsksnnyat
    yyadsvkdrftisrddsqnmlylqmnnlktedtamyycvrdqtgtawfaywgqgtlvtvs
    aakttppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqs
    glytmsssvtvpsstwpsqtvtcsvahpassttvdkkle
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cbvL (L:)
    dvvmtqtplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpltfgagtklelkradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec