PDB entry 1cbq

View 1cbq on RCSB PDB site
Description: crystal structure of cellular retinoic-acid-binding proteins I and II in complex with all-trans-retinoic acid and a synthetic retinoid
Class: retinoic-acid transport
Keywords: retinoic-acid transport
Deposited on 1994-09-28, released 1995-01-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-04-13, with a file datestamp of 2011-04-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.21
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cellular retinoic acid binding protein type II
  Species: Homo sapiens [TaxId:9606]
  Gene: HUMAN CRABP-II
  Database cross-references and differences (RAF-indexed):
  • Uniprot P29373 (0-136)
  Domains in SCOPe 2.08: d1cbqa_
• Heterogens: PO4, RE9, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cbqA (A:)
  pnfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskpaveikqegdtfyiktsttvrt
  teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtreltndgeli
  ltmtaddvvctrvyvre