PDB entry 1caz

View 1caz on RCSB PDB site
Description: wild-type and e106q mutant carbonic anhydrase complexed with acetate
Class: lyase(oxo-acid)
Keywords: lyase(oxo-acid)
Deposited on 1993-02-26, released 1993-10-31
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.153
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carbonic anhydrase II
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00918 (Start-258)
      • conflict (104)
    Domains in SCOPe 2.03: d1caza_
  • Heterogens: ZN, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cazA (A:)
    shhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslriln
    nghafnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsqhtvdkkkyaaelhlv
    hwntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdpr
    gllpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmv
    dnwrpaqplknrqikasfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cazA (A:)
    hhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnn
    ghafnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsqhtvdkkkyaaelhlvh
    wntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprg
    llpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvd
    nwrpaqplknrqikasfk