PDB entry 1cax

View 1cax on RCSB PDB site
Description: determination of three crystal structures of canavalin by molecular replacement
Class: seed storage protein
Keywords: seed storage protein
Deposited on 1993-06-10, released 1993-10-31
The last revision prior to the SCOP 1.75 freeze date was dated 1993-10-31, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.175
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: canavalin
    Species: Canavalia ensiformis
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1caxa_
  • Chain 'B':
    Compound: canavalin
    Species: Canavalia ensiformis
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1caxb_
  • Chain 'C':
    Compound: canavalin
    Species: Canavalia ensiformis
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1caxc_
  • Chain 'D':
    Compound: canavalin
    Species: Canavalia ensiformis
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1caxd_
  • Chain 'E':
    Compound: canavalin
    Species: Canavalia ensiformis
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1caxe_
  • Chain 'F':
    Compound: canavalin
    Species: Canavalia ensiformis
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1caxf_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1caxA (A:)
    aqnnpylfrsnkfltlfknqhgslrllqrfnedteklenlrdyrvleycskpntlllphh
    sdsdllvlvlegqailvlvnpdgrdtykldqgdaikiqagtpfylinpdnnqnlrilkfa
    itfrrpgtvedfflsstkrlpsylsafsknfleasydspydeieqtllqeeqegvivkmp
    k
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1caxB (B:)
    tlssqdkpfnlrsrdpiysnnygklyeitpeknsqlrdldillnclqmnegalfvphyns
    ratvilvanegraevelvgleqqqqqglesmqlrryaatlsegdiivipssfpvalkaas
    dlnmvgigvnaennernflaghkenvirqiprqvsdltfpgsgeeveellenqkesyfvd
    gqpr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1caxC (C:)
    aqnnpylfrsnkfltlfknqhgslrllqrfnedteklenlrdyrvleycskpntlllphh
    sdsdllvlvlegqailvlvnpdgrdtykldqgdaikiqagtpfylinpdnnqnlrilkfa
    itfrrpgtvedfflsstkrlpsylsafsknfleasydspydeieqtllqeeqegvivkmp
    k
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1caxD (D:)
    tlssqdkpfnlrsrdpiysnnygklyeitpeknsqlrdldillnclqmnegalfvphyns
    ratvilvanegraevelvgleqqqqqglesmqlrryaatlsegdiivipssfpvalkaas
    dlnmvgigvnaennernflaghkenvirqiprqvsdltfpgsgeeveellenqkesyfvd
    gqpr
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1caxE (E:)
    aqnnpylfrsnkfltlfknqhgslrllqrfnedteklenlrdyrvleycskpntlllphh
    sdsdllvlvlegqailvlvnpdgrdtykldqgdaikiqagtpfylinpdnnqnlrilkfa
    itfrrpgtvedfflsstkrlpsylsafsknfleasydspydeieqtllqeeqegvivkmp
    k
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1caxF (F:)
    tlssqdkpfnlrsrdpiysnnygklyeitpeknsqlrdldillnclqmnegalfvphyns
    ratvilvanegraevelvgleqqqqqglesmqlrryaatlsegdiivipssfpvalkaas
    dlnmvgigvnaennernflaghkenvirqiprqvsdltfpgsgeeveellenqkesyfvd
    gqpr