PDB entry 1caq

View 1caq on RCSB PDB site
Description: x-ray structure of human stromelysin catalytic domain complexes with non-peptide inhibitors: implication for inhibitor selectivity
Class: hydrolase
Keywords: matrix metalloproteinase, mmp-3, non-peptide inhibitor, hydrolase
Deposited on 1999-02-23, released 1999-07-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (stromelysin-1)
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P08254 (0-167)
  Domains in SCOPe 2.08: d1caqa_
• Heterogens: ZN, CA, SO4, DPS, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1caqA (A:)
  frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
  misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
  ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygppp