PDB entry 1cad

View 1cad on RCSB PDB site
Description: x-ray crystal structures of the oxidized and reduced forms of the rubredoxin from the marine hyperthermophilic archaebacterium pyrococcus furiosus
Class: electron transport
Keywords: electron transport
Deposited on 1992-05-18, released 1993-10-31
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.193
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rubredoxin
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1cada_
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cadA (A:)
    akwvckicgyiydedagdpdngispgtkfeelpddwvcpicgapksefekled